For research use only · Lyophilized · Third-party tested · 99%+ purity · Free shipping over $250 · Ships from the US · 21+

Back to Catalog
PeptidesThird-party tested99%+ purity

Tesamorelin 10 mg — Lyophilized Research Peptide

10mg • A synthetic peptide research compound.

$99.00

Research use only · not for human or veterinary use · 21+

Select Amount Per Vial
1
View COA
Specification
Tesamorelin · 10mg per vial · Lyophilized powder
Storage
Frozen / Away from light

Tesamorelin is a synthetic 44-residue peptide: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, with an N-terminal (3E)-hex-3-enoyl group. CAS 218949-48-5. Molecular formula C221H366N72O67S; molecular weight 5136 g/mol (PubChem CID 16137828). Supplied as a lyophilized powder, 10 mg label amount per sealed vial.

Third-party tested. The posted report (Freedom Diagnostics, accession 2607150706, reported 07/18/2026) shows 99.63% purity by HPLC-UV, identity confirmed by LC-MS, and 10.15 mg net content. The code printed on it, TSM10, is a supplier catalog code, not a lot number. That report was commissioned by our supplier (client on report: LP Peptide) and is published unaltered.

Store frozen, away from light.

Full specifications
Specifications
FieldValueSource
SequenceYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, N-terminal (3E)-hex-3-enoylPubChem CID 16137828 (sequence notation + synonym '(3E)-hex-3-enoylsomatoliberin')
CAS218949-48-5PubChem CID 16137828
Molecular formulaC221H366N72O67SPubChem CID 16137828
Molecular weight5136 g/molPubChem CID 16137828
FormLyophilized powder, sealed vialSite catalog
StorageStore frozen, away from lightSite catalog
Posted reportFreedom Diagnostics, accession 2607150706, reported 07/18/2026; report code TSM10 (a supplier catalog code, not a lot number); purity 99.63% (HPLC-UV); net content 10.15 mg; identity confirmed (LC-MS); client on report: LP Peptide (supplier)COA index + PDF

Compliance & research-use terms