Tesamorelin 10 mg — Lyophilized Research Peptide
10mg • A synthetic peptide research compound.
Research use only · not for human or veterinary use · 21+
Tesamorelin is a synthetic 44-residue peptide: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, with an N-terminal (3E)-hex-3-enoyl group. CAS 218949-48-5. Molecular formula C221H366N72O67S; molecular weight 5136 g/mol (PubChem CID 16137828). Supplied as a lyophilized powder, 10 mg label amount per sealed vial.
Third-party tested. The posted report (Freedom Diagnostics, accession 2607150706, reported 07/18/2026) shows 99.63% purity by HPLC-UV, identity confirmed by LC-MS, and 10.15 mg net content. The code printed on it, TSM10, is a supplier catalog code, not a lot number. That report was commissioned by our supplier (client on report: LP Peptide) and is published unaltered.
Store frozen, away from light.
Full specifications
| Field | Value | Source |
|---|---|---|
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL, N-terminal (3E)-hex-3-enoyl | PubChem CID 16137828 (sequence notation + synonym '(3E)-hex-3-enoylsomatoliberin') |
| CAS | 218949-48-5 | PubChem CID 16137828 |
| Molecular formula | C221H366N72O67S | PubChem CID 16137828 |
| Molecular weight | 5136 g/mol | PubChem CID 16137828 |
| Form | Lyophilized powder, sealed vial | Site catalog |
| Storage | Store frozen, away from light | Site catalog |
| Posted report | Freedom Diagnostics, accession 2607150706, reported 07/18/2026; report code TSM10 (a supplier catalog code, not a lot number); purity 99.63% (HPLC-UV); net content 10.15 mg; identity confirmed (LC-MS); client on report: LP Peptide (supplier) | COA index + PDF |